| Pep04441 |
Scyliorhinin I |
AKFDKFYGLM-NH2 |
103425-21-4 |
| Pep04434 |
(Nle6)-Sarafotoxin C |
CTCND-Nle-TDEECLNFCHQDVIW |
352283-69-3 |
| Pep04433 |
Sarafotoxin C |
CTCNDMTDEECLNFCHQDVIW |
121695-87-2 |
| Pep04432 |
Sarafotoxin B |
CSCKDMTDKECLYFCHQDVIW |
120972-53-4 |
| Pep04431 |
Sarafotoxin A |
CSCKDMTDKECLNFCHQDVIW |
126738-34-9 |
| Pep04402 |
(Lys18)-Pseudin-2 |
GLNALKKVFQGIHEAIKKINNHVQ |
Pep04402 |
| Pep04401 |
Pseudin-2 |
GLNALKKVFQGIHEAIKLINNHVQ |
Pep04401 |
| Pep04396 |
Prolactin-Releasing Peptide (12-31) (rat) |
TPDINPAWYTGRGIRPVGRF-NH2 |
222988-10-5 |
| Pep04395 |
Prolactin-Releasing Peptide (12-31) (human) |
TPDINPAWYASRGIRPVGRF-NH2 |
235433-36-0 |
| Pep04394 |
Prolactin-Releasing Peptide (12-31) (bovine) |
TPDINPAWYAGRGIRPVGRF-NH2 |
Pep04394 |
| Pep04393 |
Prolactin-Releasing Peptide (1-31) (rat) |
SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2 |
215510-06-8 |
| Pep04392 |
Prolactin-Releasing Peptide (1-31) (human) |
SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2 |
215510-22-8 |
| Pep04391 |
Prolactin-Releasing Peptide (1-31) (bovine) |
SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF-NH2 |
Pep04391 |
| Pep04382 |
Procathepsin B (36-50) (rat) |
SYLKKLCGTVLGGPK-NH2 |
317331-26-3 |
| Pep04371 |
Pneumadin (rat) |
YGEPKLDAGV-NH2 |
130918-90-0 |
| Pep04381 |
Procathepsin B (26-50) (rat) |
AGRNFYNVDISYLKKLCGTVLGGPK-NH2 |
317331-27-4 |
| Pep04362 |
Platelet Factor 4 (58-70) (human) |
PLYKKIIKKLLES |
82989-21-7 |
| Pep04361 |
(Gln18)-Platelet Factor 4 (15-22) (human) |
TTSQVRPR |
144207-60-3 |
| Pep04359 |
PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) |
YKQRVKNK-NH2 |
138764-85-9 |
| Pep04358 |
PACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) |
GKRYKQRVKNK-NH2 |
160489-86-1 |
|